CD9 Polyclonal antibody proteintech 20597-1-AP
$449.00
In stock
SKU
20597-1-AP
5H9, 5H9 antigen, BA2, BTCC 1, CD9 antigen
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (9) | Immunogen: CatNo: Ag14546 Product name: Recombinant human CD9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 228 aa, 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011988 |
| Conjugate: Unconjugated | Gene Symbol: CD9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 928 |
| Application: Western Blot (WB) | RRID: AB_2878706 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, it may be due to the difference of glycosylations (PMID: 8701996). |
Reviews
Write Your Own Review