OXTR Polyclonal antibody proteintech 23045-1-AP
$449.00
In stock
SKU
23045-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag19074 Product name: Recombinant human OXTR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 327-389 aa of BC137443 Sequence: WIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 389 aa, 43 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC137443 |
| Conjugate: Unconjugated | Gene Symbol: OXTR |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5021 |
| Application: Western Blot (WB) | RRID: AB_2827425 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Oxytocin (OXT) is a neurohypophysial hormone that plays a role in lactation and parturition and in the central nervous system as a neurotransmitter involved in sex and maternal behavior (PMID: 1852313; 10811917). OXT acts through its receptor, OXTR, which belongs to the G protein-coupled 7-transmembrane receptor family. OXTR is expressed in the endometrium, myometrium, and mammary gland (PMID: 1313946). This antibody is raised against the C-terminal region of human OXTR. Two immunoreactive OXTR bands were found in the fat tissue, an unglycosylated 43 kDa form and a mature glycosylated 67 kDa form (PMID:32819381). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
