CHCHD10 Polyclonal antibody proteintech 25671-1-AP
$449.00
In stock
SKU
25671-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC065232 |
| Conjugate: Unconjugated | Gene Symbol: CHCHD10 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 400916 |
| Application: Western Blot (WB) | RRID: AB_2880187 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
