CD8a Polyclonal antibody proteintech 29896-1-AP
$449.00
In stock
SKU
29896-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Mouse And More (1) | Immunogen: CatNo: Ag31942 Product name: Recombinant mouse CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-196 aa of NM_001081110 Sequence: KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY Predict reactive species |
| Applications: WB, IF-Fro, ELISA | Observed Molecular Weight: 27KD |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001081110 |
| Conjugate: Unconjugated | Gene Symbol: Cd8a |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 12525 |
| Application: Western Blot (WB) | RRID: AB_2935485 |
| Dilution: WB : 1:1000-1:5000 | Conjugate: Unconjugated |
| Tested Reactivity: Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 is composed of two disulfide-linked chains and can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
