Vimentin Polyclonal antibody proteintech 22031-1-AP
$449.00
In stock
SKU
22031-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag16898 Product name: Recombinant human Vimentin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000163 Sequence: MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDF Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 466 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000163 |
| Conjugate: Unconjugated | Gene Symbol: VIM |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7431 |
| Application: Western Blot (WB) | RRID: ENSG00000026025 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: AB_11182825 |
| Tested Reactivity: Human, Mouse, Rat | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: Vimentin, also named as VIM, belongs to the intermediate filament family. Vimentin is class-III intermediate filaments found in various non-epithelial cells, especially mesenchymal cells. Vimentin is important for stabilizing the architecture of the cytoplasm. Monocyte-derived macrophages secrete vimentin into the extracellular space in vitro. Secretion of vimentin was enhanced by the proinflammatory cytokine tumor necrosis factor-alpha (TNFA; 191160) and inhibited by the antiinflammatory cytokine IL10 (124092), suggesting that vimentin is involved in the immune response. Vimentin has specialized functions that contribute to specific dynamic cellular processes. As a phosphoprotein, 55-60 kDa of vimentin proteins can be observed due to the different phosphorylation level. Isoforms of vimentin (49 kDa and 60 kDa) had also been reported. (PMID: 8640945, 22728585). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
