OAT1 Polyclonal antibody proteintech 26574-1-AP
$449.00
In stock
SKU
26574-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag24234 Product name: Recombinant human SLC22A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 476-550 aa of BC033682 Sequence: SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 62 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC033682 |
| Conjugate: Unconjugated | Gene Symbol: OAT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9356 |
| Application: Western Blot (WB) | RRID: AB_2880557 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: OAT1, also named as SLC22A6, has two GXXXG motifs in its transmembrane which is associated with protein processing and oligomerization of other proteins. OAT1 is involved in the renal elimination of endogenous and exogenous organic anions. It has been reported that OAT1 plays a key role in clearing endogenous metabolites, toxins and drugs from blood. OAT1 has some isoforms and the calculated MW ranges from 55 kDa to 62 kDa. 26574-1-AP antibody detects the 60-65 kDa (native forms) and 70-80 kDa (mature forms) protein in SDS-PAGE. (PMID: 21340049, 23389457, 23196129) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
