BAK Polyclonal antibody proteintech 29552-1-AP
$449.00
In stock
SKU
29552-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag31042 Product name: Recombinant human BAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001188 Sequence: MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 23 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001188 |
| Conjugate: Unconjugated | Gene Symbol: BAK1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 578 |
| Application: Western Blot (WB) | RRID: AB_2923596 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
