Syntenin-1 Polyclonal antibody proteintech 22399-1-AP
$449.00
In stock
SKU
22399-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 298 aa, 32 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC113674 |
| Conjugate: Unconjugated | Gene Symbol: Syntenin-1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6386 |
| Application: Western Blot (WB) | RRID: AB_2879100 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. |