Phospholemman/FXYD1 Polyclonal antibody proteintech 13721-1-AP
$449.00
In stock
SKU
13721-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag4669 Product name: Recombinant human FXYD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC032800 Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Predict reactive species |
| Applications: WB, IP, IF, IHC, ELISA | Observed Molecular Weight: 92 aa, 10 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032800 |
| Conjugate: Unconjugated | Gene Symbol: FXYD1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5348 |
| Application: Western Blot (WB) | RRID: AB_2108296 |
| Dilution: WB : 1:500-1:1500 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
