KL Polyclonal antibody proteintech 28100-1-AP
$449.00
In stock
SKU
28100-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag27759 Product name: Recombinant human KL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 34-184 aa of NM_004795 Sequence: MEPGDGAQTWARFSRPPAPEAAGLFQGTFPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPATGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERLRELG Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 116 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_004795 |
| Conjugate: Unconjugated | Gene Symbol: KL |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9365 |
| Application: Western Blot (WB) | RRID: AB_2881060 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
