MIF Polyclonal antibody proteintech 20415-1-AP
$449.00
In stock
SKU
20415-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species |
| Applications: WB, IF/ICC, FC (Intra), IP, ELISA | Observed Molecular Weight: 115 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000447 |
| Conjugate: Unconjugated | Gene Symbol: MIF |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4282 |
| Application: Western Blot (WB) | RRID: AB_10694820 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates. |
Reviews
Write Your Own Review