GPX1 Polyclonal antibody proteintech 29329-1-AP
$449.00
In stock
SKU
29329-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (6) | Immunogen: CatNo: Ag31101 Product name: Recombinant human GPX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-203 aa of BC000742 Sequence: GGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000742 |
| Conjugate: Unconjugated | Gene Symbol: GPX1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2876 |
| Application: Western Blot (WB) | RRID: AB_2918283 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Gpx protein, known as selenoprotein, consists selenium in its catalytic site. Gpx1 is an abundant isoform, which involves in scavenging endogenous ROS using electron provided by reduced glutathione and ubiquitously expressed the cytoplasm and mitochondria of all cell types. (PMID: 30632027) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
