SSBP1 Polyclonal antibody proteintech 12212-1-AP
$449.00
In stock
SKU
12212-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag2860 Product name: Recombinant human SSBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC000895 Sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ChIP, ELISA | Observed Molecular Weight: 148 aa, 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000895 |
| Conjugate: Unconjugated | Gene Symbol: SSBP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6742 |
| Application: Western Blot (WB) | RRID: AB_2195320 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SSBP1 is a housekeeping gene involved in mitochondrial biogenesis. it binds preferentially and cooperatively to ss-DNA in the maintainance of genome stability. SSBP1 acted as a homotetramer to stabilize the displaced single strand of the normal and expanded displacement loop (D loop) during mtDNA replication, thus preventing formation of secondary single-stranded DNA structures, which could stop the gamma-DNA polymerase |
Reviews
Write Your Own Review