NDUFA4L2 Polyclonal antibody proteintech 16480-1-AP
$449.00
In stock
SKU
16480-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 87 aa, 10 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011910 |
| Conjugate: Unconjugated | Gene Symbol: NDUFA4L2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 56901 |
| Application: Western Blot (WB) | RRID: AB_2150637 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
