CHCHD4 Polyclonal antibody proteintech 21090-1-AP
$449.00
In stock
SKU
21090-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag15339 Product name: Recombinant human CHCHD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC033775 Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 142 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC033775 |
| Conjugate: Unconjugated | Gene Symbol: CHCHD4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 131474 |
| Application: Western Blot (WB) | RRID: AB_10734583 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CHCHD4, a component of human mitochondria, belongs to a protein family. It functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. It is required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). |
Reviews
Write Your Own Review