Cannabinoid receptor 1 Polyclonal antibody proteintech 17978-1-AP
$449.00
In stock
SKU
17978-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag12371 Product name: Recombinant human CNR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 472 aa, 53 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC074812 |
| Conjugate: Unconjugated | Gene Symbol: Cannabinoid receptor 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1268 |
| Application: Western Blot (WB) | RRID: AB_10859098 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. |
Reviews
Write Your Own Review