S100A14 Polyclonal antibody proteintech 10489-1-AP
$449.00
In stock
SKU
10489-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Rat And More (1) | Immunogen: CatNo: Ag0757 Product name: Recombinant human S100A14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC005019 Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005019 |
| Conjugate: Unconjugated | Gene Symbol: S100A14 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 57402 |
| Application: Western Blot (WB) | RRID: AB_2183628 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
