Beta Actin Polyclonal antibody proteintech 20536-1-AP
$189.00
In stock
SKU
20536-1-AP
Actin, ACTB, bate actin, β actin, Beta-actin
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Canine, Monkey And More (7) | Immunogen: CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 375 aa, 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002409 |
| Conjugate: Unconjugated | Gene Symbol: Beta Actin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 60 |
| Application: Western Blot (WB) | RRID: AB_10700003 |
| Dilution: WB : 1:4000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Canine, Monkey | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 ) |