MARCH8 Polyclonal antibody proteintech 14119-1-AP
$449.00
In stock
SKU
14119-1-AP
MARCHF8, c-MIR, E3 ubiquitin-protein ligase MARCHF8, EC:2.3.2.27, MARCH-VIII
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag5268 Product name: Recombinant human MARCH8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC066988 Sequence: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCS Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC066988 |
| Conjugate: Unconjugated | Gene Symbol: MARCH8 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 220972 |
| Application: Western Blot (WB) | RRID: AB_2140168 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MARCH8 (Membrane-associated RING finger protein 8) is also named as MIR, RNF178 and belongs to the RING zinc finger protein family. It functions as an E3 ubiquitin ligase for immune recognition-related molecules (e.g. major histocompatibility complex class I, B7-2, and ICAM-1). It plays a key role in controlling MHC class II surface expression by regulated ubiquitination of a lysine residue in the beta-chain (PMID:22761441). |
Reviews
Write Your Own Review