LASP1 Polyclonal antibody proteintech 10515-1-AP
$449.00
In stock
SKU
10515-1-AP
MLN50, LIM and SH3 protein 1, LASP-1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag0800 Product name: Recombinant human LASP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 30 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012460 |
| Conjugate: Unconjugated | Gene Symbol: LASP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3927 |
| Application: Western Blot (WB) | RRID: ENSG00000002834 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: AB_2280966 |
| Tested Reactivity: Human, Mouse | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
