Anti-Human TMEM119 Rabbit Recombinant Antibody Proteintech 98677-3-RR
$299.00
In stock
SKU
98677-3-RR
OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1823 Product name: Recombinant human TMEM119 protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-96 aa of NM_181724 Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：338773 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q4V9L6 | Formulation:：PBS, Azide6 |
| Background Information：TMEM119 (Transmembrane Protein 119), also known as OBIF (Osteoblast Induction Factor), is a type I transmembrane protein that serves as a highly specific marker for resident microglia in the central nervous system (CNS). TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
