Anti-Human IL-33 Rabbit Recombinant Antibody Proteintech 98364-2-RR
$299.00
In stock
SKU
98364-2-RR
IL33, 109-270, 95-270, 99-270, C9orf26
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg7061 Product name: Recombinant human IL33 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 122-270 aa of BC047085 Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：90865 | Formulation:：PBS, Azide5 |
| Storage Buffer：O95760 | Formulation:：PBS, Azide6 |
| Background Information：IL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
