Anti-Human CXCL7/PPBP Rabbit Recombinant Antibody Proteintech 98578-2-RR
$299.00
In stock
SKU
98578-2-RR
CXCL7, NAP-2, PPBP, PPBP/NAP2, Beta-thromboglobulin
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3690 Product name: Recombinant Human CXCL7/PBP protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 59-128 aa of NM_002704.3 Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：5473 | Formulation:：PBS, Azide5 |
| Storage Buffer：P02775 | Formulation:：PBS, Azide6 |
| Background Information：PPBP, slso named as NAP2, or β-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
