Anti-Guinea Pig CD8b Rabbit Recombinant Antibody Proteintech 98585-1-RR
$299.00
In stock
SKU
98585-1-RR
CD8 subunit beta
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg7177 Product name: Recombinant guinea pig CD8B protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-168 aa of NM_001172877.1 Sequence: LQQSPHFLMLQTNQSATMTCESKTSSINGRLYWLRQRGAPSPDSHHEFLASGDFSNNIVYGRGMTSEMLTLSRLSTRFTLSLKHVKPEDSGVYFCMTIGHPELTFGMGTNLSVVDVLPTTAQPTTKTTPKKKKCQPPSPGPQKGLHC Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：100379572 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q6W8W7 | Formulation:：PBS, Azide6 |
| Background Information：CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
