Anti-Guinea Pig CD8a Rabbit Recombinant Antibody Proteintech 98639-1-RR
$299.00
In stock
SKU
98639-1-RR
CD8 subunit alpha, CD8a molecule
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg7178 Product name: Recombinant guinea pig CD8A protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 24-176 aa of NM_001172876.1 Sequence: QGASQFRMSPRELVAQVGTKVTLRCEVLVPNAPAGCSWLFQPRHDAKGPTFLLYHSASGTKLAPGLEQKRFSPSKSSNTYTLTVNSFQKRDEGYYFCSVSGNMMLYFSPFVPVFLPAPRTTTPPPPPTTPTPSVQPTSVRPETCVVSKGAAGA Predict reactive species | Formulation::PBS, Azide4 |
| RRID:100379570 | Formulation::PBS, Azide5 |
| Storage Buffer:Q6W8W8 | Formulation::PBS, Azide6 |
| Background Information:CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells , on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084). | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC)0 |