FcZero-rAb? CoraLite? Plus 488 Anti-Rat CD90 Rabbit Recombinant Antibody Proteintech CL488-FcA98162
$299.00
In stock
SKU
CL488-FcA98162
241388F3, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：24832 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide6 |
| Background Information：CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
