FcZero-rAb? CoraLite? Plus 488 Anti-Rat CD90 Rabbit Recombinant Antibody Proteintech CL488-FcA98162
$299.00
In stock
SKU
CL488-FcA98162
241388F3, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species | Formulation::PBS, Azide4 |
| RRID:24832 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purification | Formulation::PBS, Azide6 |
| Background Information:CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034). | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC)0 |