FcZero-rAb? APC Anti-Mouse Glycophorin A/CD235a Rabbit Recombinant Antibody Proteintech APC-FcA98269
$299.00
In stock
SKU
APC-FcA98269
glycophorin A, CD235a, Glycophorin-A, GPA, Gypa
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg1886 Product name: Recombinant Mouse Glycophorin A protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 1-108 aa of NM_010369.3 Sequence: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：14934 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
