FcZero-rAb? APC Anti-Mouse Fas/CD95 Rabbit Recombinant Antibody Proteintech APC-FcA98135
$299.00
In stock
SKU
APC-FcA98135
CD95, Fas, APO 1, APT1, TNFR6
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg1376 Product name: Recombinant Mouse Fas/CD95 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-169 aa of NM_007987.2 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：14102 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：Fas (CD95/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation. | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
