FcZero-rAb? APC Anti-Mouse CD83 Rabbit Recombinant Antibody Proteintech APC-FcA98119
$299.00
In stock
SKU
APC-FcA98119
CD83 antigen, mCD83
| Formulation::PBS, Azide, BSA | Formulation::PBS, Azide, BSA1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide, BSA2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, BSA3 |
| Type:CatNo: Eg1387 Product name: Recombinant Mouse CD83 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-133 aa of NM_009856.3 Sequence: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYR Predict reactive species | Formulation::PBS, Azide, BSA4 |
| RRID:12522 | Formulation::PBS, Azide, BSA5 |
| Storage Buffer:Protein A purification | Formulation::PBS, Azide, BSA6 |
| Background Information:CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928). | Formulation::PBS, Azide, BSA7 |
| biogegep8 | Formulation::PBS, Azide, BSA8 |
| biogegep9 | Formulation::PBS, Azide, BSA9 |
| Formulation::PBS, Azide, BSA0 | Applications:Flow Cytometry (FC)0 |