FcZero-rAb? Biotin Anti-Mouse CCL3/MIP-1 alpha Rabbit Recombinant Antibody Proteintech Biotin-FcA98194

$299.00
In stock
SKU
Biotin-FcA98194

 

C-C motif chemokine 3, Ccl3, Heparin-binding chemotaxis protein, L2G25B, Macrophage inflammatory protein 1-alpha

Formulation::PBS, Azide Formulation::PBS, Azide1
Applications:Flow Cytometry (FC) (INTRA) Formulation::PBS, Azide2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide3
Type:CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species Formulation::PBS, Azide4
RRID:20302 Formulation::PBS, Azide5
Storage Buffer:Protein A purification Formulation::PBS, Azide6
Background Information:Chemokine (C-C motif) ligand 3 (CCL3), also known as MIP-1α, belongs to the family of chemokines. CCL3 has been found in the central nervous system and its cognate receptors, CCR1 and CCR5, have been reported to be expressed by astrocytes, microglia and neurons. CCL3 and its receptors, CCR1 and CCR5, also contribute to the development of bone disease in multiple myeloma by supporting tumor growth and regulating osteoclast differentiation. CCL3 is also associated with the regulation of cell growth, angiogenesis, and metastasis of different tumors such as melanoma, renal cell carcinoma, and colorectal cancer. Moreover, CCL3 enhances cell migration and metastasis by up-regulating matrix metalloproteinase-2 (MMP)-2 expression in chondrosarcoma cells. Formulation::PBS, Azide7
biogegep8 Formulation::PBS, Azide8
biogegep9 Formulation::PBS, Azide9
Formulation::PBS, Azide0 Applications:Flow Cytometry (FC) (INTRA)0

 

 

Reviews

Write Your Own Review
You're reviewing:FcZero-rAb? Biotin Anti-Mouse CCL3/MIP-1 alpha Rabbit Recombinant Antibody Proteintech Biotin-FcA98194
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.