FcZero-rAb? APC Anti-Human TWEAKR/CD266 Rabbit Recombinant Antibody Proteintech APC-FcA98125
$299.00
In stock
SKU
APC-FcA98125
CD266, TNFRSF12A, TweakR, 240991C5, APO3L
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：51330 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：TWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TWEAKR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TWEAKR expression by other growth factors and/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185) | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
