FcZero-rAb? Biotin Anti-Human IL-7 Rabbit Recombinant Antibody Proteintech Biotin-FcA98206
$299.00
In stock
SKU
Biotin-FcA98206
IL7, IL 7, interleukin 7, Interleukin-7
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg0830 Product name: Recombinant Human IL-7 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-177 aa of NM_000880.4 Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH Predict reactive species | Formulation::PBS, Azide4 |
| RRID:3574 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purification | Formulation::PBS, Azide6 |
| Background Information:Interleukin-7 (IL-7) is a cytokine involved in B and T cell development. It plays an active role in the development, survival, maintaining and restoring homeostasis of mature T lymphocytes and is a key regulator of the commitment, survival, proliferation and maturation of B cells during development. Furthermore, IL-7 can improve the antiviral function and expansion of natural killer (NK) cells and regulate the development and differentiation of dendritic cells. IL-7 has also been reported as a regulator of the development of central nervous system and myogenesis and skeletal muscle cell migration. (PMID: 29663382; 29655570; 29449560) | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC) (INTRA)0 |