FcZero-rAb? APC Anti-Human IL-1 beta Rabbit Recombinant Antibody Proteintech APC-FcA98142

$299.00
In stock
SKU
APC-FcA98142

 

240902A3, Catabolin, IL 1, IL 1 beta, IL1 beta

Formulation::PBS, Azide, BSA Formulation::PBS, Azide, BSA1
Applications:Flow Cytometry (FC) (INTRA) Formulation::PBS, Azide, BSA2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, BSA3
Type:CatNo: Eg0286 Product name: Recombinant Human IL-1 Beta protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Formulation::PBS, Azide, BSA4
RRID:3553 Formulation::PBS, Azide, BSA5
Storage Buffer:Liquid Formulation::PBS, Azide, BSA6
Background Information:Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Formulation::PBS, Azide, BSA7
biogegep8 Formulation::PBS, Azide, BSA8
biogegep9 Formulation::PBS, Azide, BSA9
Formulation::PBS, Azide, BSA0 Applications:Flow Cytometry (FC) (INTRA)0

 

 

Reviews

Write Your Own Review
You're reviewing:FcZero-rAb? APC Anti-Human IL-1 beta Rabbit Recombinant Antibody Proteintech APC-FcA98142
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.