FcZero-rAb? Biotin Anti-Human GPR56 Rabbit Recombinant Antibody Proteintech Biotin-FcA98291
$299.00
In stock
SKU
Biotin-FcA98291
ADGRG1, ADGRG1 CT, ADGRG1 C-terminal fragment, ADGRG1 NT, ADGRG1 N-terminal fragment
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2478 Product name: Recombinant Human GPR56 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 26-171 aa of NM_001145771.2 Sequence: RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：9289 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide6 |
| Background Information：GPR56 (G-protein-coupled receptor 56, also named ADGRG1) is a member of the adhesion G-protein coupled receptor (aGPCR) family and one of the important players in the normal development of the brain. It plays a pivotal role in diverse neurobiological processes, including cortical formation, oligodendrocyte development, and myelination (PMID: 32798453). Moreover, GPR56 has been reported to regulate VEGF secretion and angiogenesis in melanoma (PMID: 37579299). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
