FcZero-rAb? APC Anti-Human BCMA/TNFRSF17 Rabbit Recombinant Antibody Proteintech APC-FcA98215
$299.00
In stock
SKU
APC-FcA98215
TNFRSF17, B-cell maturation protein, BCM, BCMA, CD269
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg1812 Product name: Recombinant Human TNFRSF17 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-54 aa of BC058291 Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：608 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：BCMA (B cell maturation antigen), also known as TNFRSF17, is 20.2-kDa type III transmembrane glycoprotein and is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes and plasma cells, which may be important for B cell development and autoimmune response (PMID: 32943087; 9846698). BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and BAFF. When BCMA binds to APRIL, it transmits signals of cell survival and proliferation (PMID: 27127303); when BCMA binds to BAFF, it mediates the activation of NF-kappaB and MAPK8/JNK (PMID: 36140254). It has been found that the overexpression and activation of BCMA are associated with multiple myeloma (MM) in preclinical models and humans, supporting its potential utility as a therapeutic target for MM (PMID: 32055000; 32943087). | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
