Anti-Rat Beta-2-Microglobulin Rabbit Recombinant Antibody Proteintech 98429-1-RR
$299.00
In stock
SKU
98429-1-RR
B2m, beta 2-Microglobulin, Beta-2-microglobulin form pI 5.3, CDABP0092, HDCMA22P
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3270 Product name: Recombinant Rat Beta-2-Microglobulin protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-119 aa of NM_012512.2 Sequence: IQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELLKNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：24223 | Formulation:：PBS, Azide5 |
| Storage Buffer：P07151 | Formulation:：PBS, Azide6 |
| Background Information：Beta-2-microglobulin (B2M) is a component of MHC class I molecules, which are present on the surface of nearly all nucleated cells. It can be found in body fluids under physiologic conditions due to shedding from cell surfaces or intracellular release. B2M has various biological functions, including antigen presentation. Investigations reveal that increased synthesis and release of B2M are present in several malignant diseases. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
