Anti-Pig IL-1 beta Rabbit Recombinant Antibody Proteintech 98640-1-RR
$299.00
In stock
SKU
98640-1-RR
IL1B, IL 1 beta, IL 1beta, interleukin 1 beta, Interleukin-1 beta
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg4869 Product name: Recombinant Pig IL-1 beta protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 115-267 aa of NM_214055.1 Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：397122 | Formulation:：PBS, Azide5 |
| Storage Buffer：P26889 | Formulation:：PBS, Azide6 |
| Background Information：Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
