Anti-Pig IL-1 beta Rabbit Recombinant Antibody Proteintech 98640-1-RR

$299.00
In stock
SKU
98640-1-RR

 

IL1B, IL 1 beta, IL 1beta, interleukin 1 beta, Interleukin-1 beta

Formulation::PBS, Azide Formulation::PBS, Azide1
Applications:Flow Cytometry (FC) (INTRA) Formulation::PBS, Azide2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide3
Type:CatNo: Eg4869 Product name: Recombinant Pig IL-1 beta protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 115-267 aa of NM_214055.1 Sequence: ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP Predict reactive species Formulation::PBS, Azide4
RRID:397122 Formulation::PBS, Azide5
Storage Buffer:P26889 Formulation::PBS, Azide6
Background Information:Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Formulation::PBS, Azide7
biogegep8 Formulation::PBS, Azide8
biogegep9 Formulation::PBS, Azide9
Formulation::PBS, Azide0 Applications:Flow Cytometry (FC) (INTRA)0

 

 

Reviews

Write Your Own Review
You're reviewing:Anti-Pig IL-1 beta Rabbit Recombinant Antibody Proteintech 98640-1-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.