Anti-Pig IFN-gamma Rabbit Recombinant Antibody Proteintech 98702-2-RR
$299.00
In stock
SKU
98702-2-RR
IFNG, IFN gamma, IFN γ, IFNγ, IFN-γ
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg4538 Product name: Recombinant Pig IFN-gamma protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-166 aa of NM_213948.1 Sequence: QAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：396991 | Formulation:：PBS, Azide5 |
| Storage Buffer：P17803 | Formulation:：PBS, Azide6 |
| Background Information：Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427) | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
