Anti-Mouse VISTA Rabbit Recombinant Antibody Proteintech 98487-2-RR
$299.00
In stock
SKU
98487-2-RR
Dies1, PD-1H, Platelet receptor Gi24, V-set domain-containing immunoregulatory receptor, V-set immunoregulatory receptor
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2809 Product name: Recombinant Mouse VISTA protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 33-191 aa of NM_001159572.1 Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：74048 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9D659 | Formulation:：PBS, Azide6 |
| Background Information：VISTA, also known as platelet receptor Gi24, B7-H5, C10orf54, Dies1, PD-1H, and SISP1, is a member of the immunoglobulin superfamily. It serves not only as a positive regulator but also as a substrate of MT1-MMP and contributes at least in part to tumor invasion. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
