Anti-Mouse TNFRSF13B/CD267 Rabbit Recombinant Antibody Proteintech 98439-2-RR
$299.00
In stock
SKU
98439-2-RR
CD267, Taci, Tnfrsf13b, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1814 Product name: Recombinant Mouse TNFRSF13B/CD267 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 5-128 aa of NM_021349.1 Sequence: FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYC Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：57916 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9ET35 | Formulation:：PBS, Azide6 |
| Background Information：Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
