Anti-Mouse S100A8 Rabbit Recombinant Antibody Proteintech 98467-2-RR
$299.00
In stock
SKU
98467-2-RR
Caga, Calgranulin-A, Chemotactic cytokine CP-10, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2959 Product name: recombinant mouse S100a8 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 2-89 aa of NM_013650.2 Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：20201 | Formulation:：PBS, Azide5 |
| Storage Buffer：P27005 | Formulation:：PBS, Azide6 |
| Background Information：S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
