Anti-Mouse MCP-1/CCL2 Rabbit Recombinant Antibody Proteintech 98028-1-RR
$299.00
In stock
SKU
98028-1-RR
Ccl2, MCP1, MCP-1, 230483A9, C-C motif chemokine 2
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0427 Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：AB_3672173 | Formulation:：PBS, Azide5 |
| Storage Buffer：P10148 | Formulation:：PBS, Azide6 |
| Background Information：Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
