Anti-Mouse Ly-6G Rabbit Recombinant Antibody Proteintech 98284-1-RR
$299.00
In stock
SKU
98284-1-RR
Ly6g, 242141B11, Ly 6G, Ly-6G.1
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：546644 | Formulation:：PBS, Azide5 |
| Storage Buffer：P35461 | Formulation:：PBS, Azide6 |
| Background Information：Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901). This antibody specifically recognizes Ly-6G, but not Ly-6C. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
