Anti-Mouse Ly-6G Rabbit Recombinant Antibody Proteintech 98284-1-RR
$299.00
In stock
SKU
98284-1-RR
Ly6g, 242141B11, Ly 6G, Ly-6G.1
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg2609 Product name: Recombinant Mouse Ly6g protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 21-114 aa of NM_001310438.1 Sequence: AERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSS Predict reactive species | Formulation::PBS, Azide4 |
| RRID:546644 | Formulation::PBS, Azide5 |
| Storage Buffer:P35461 | Formulation::PBS, Azide6 |
| Background Information:Ly-6G (lymphocyte antigen 6 complex, locus G), also known as Gr-1, is a 21-25 kDa, glycosylphosphatidylinositol-anchored protein expressed on myeloid lineage cells in mouse bone marrow (PMID: 8360469). The expression of Ly-6G increases on neutrophils as they differentiate from immature cells in the bone marrow to mature cells in the blood and spleen (PMID: 8890901). This antibody specifically recognizes Ly-6G, but not Ly-6C. | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC)0 |