Anti-Mouse IL-4 Rabbit Recombinant Antibody Proteintech 98360-2-RR
$299.00
In stock
SKU
98360-2-RR
242736G8, Il 4, Il4, interleukin 4
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3750 Product name: Recombinant Mouse IL-4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC027514 Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：Unconjugated | Formulation:：PBS, Azide5 |
| Storage Buffer：PBS with 0.09% sodium azide, pH 7.3. | Formulation:：PBS, Azide6 |
| Background Information：Interleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408) | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
