Anti-Mouse IL-25/IL-17E Rabbit Recombinant Antibody Proteintech 98536-3-RR
$299.00
In stock
SKU
98536-3-RR
Il17e, IL-17E, Il25, IL-25, Interleukin-17E
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg3316 Product name: recombinant mouse IL25/IL-17E protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-169 aa of NM_080729.3 Sequence: VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：140806 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q8VHH8 | Formulation:：PBS, Azide6 |
| Formulation:：PBS, Azide7 | |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
