Anti-Mouse IL-17F Rabbit Recombinant Antibody Proteintech 98019-1-RR
$299.00
In stock
SKU
98019-1-RR
Il17f, 230026G6, C87042, IL 17F, IL-17
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg0671 Product name: Recombinant Mouse IL-17F protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-161 aa of NM_145856.2 Sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA Predict reactive species | Formulation::PBS, Azide4 |
| RRID:257630 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purfication | Formulation::PBS, Azide6 |
| Background Information:The interleukin 17 (IL-17) family of cytokines contains 6 structurally related cytokines, IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 family plays crucial roles in host defense against microbial organisms and in the development of inflammatory diseases. IL-17A is a pro-inflammatory cytokine that also has the capacity to promote angiogenesis and osteoclastogenesis. IL-17F shares the highest homology with IL-17A and signals via a receptor composed by the IL-17RA and IL-17RC subunits. IL-17A and IL-17F can form IL-17A/A or IL-17F/F homodimers, IL-17A/F heterodimers are also formed. IL-17A and IL-17F, produced by the Th17 CD4(+) T cell lineage, have been linked to a variety of inflammatory and autoimmune conditions. IL-17F levels are elevated in sera and lesional psoriatic skin compared to non-lesional tissue. IL-17F also has been implicated in the development of neutrophilic airway inflammation. | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC) (INTRA)0 |