Anti-Mouse IL-15RA Rabbit Recombinant Antibody Proteintech 98406-2-RR
$299.00
In stock
SKU
98406-2-RR
CD215, IL-15 receptor subunit alpha, Il15ra, IL-15R-alpha, Interleukin-15 receptor subunit alpha
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2687 Product name: Recombinant Mouse IL-15RA protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 33-205 aa of NM_008358.2 Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：16169 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q60819-1 | Formulation:：PBS, Azide6 |
| Background Information：Interleukin-15 (IL-15) is a pleiotropic cytokine that plays an important role in both innate and adaptive immunity. IL-15 is mainly produced by activated monocytes, macrophages and dendritic cells, and is structurally similar to IL-2 (PMID: 8178155; 12401478). These two cytokines share the same IL-2/15Rβ and common γ-chain receptor subunits. In addition, IL-2 and IL-15 have their own private α-chain receptor subunit, IL-2Rα and IL-15Rα, respectively (PMID: 7641685). The IL-15Rα chain is expressed by many cell types including monocytes, DCs, NK, T cells and fibroblasts. Several isoforms of IL-15Rα exist and are generated either by alternative splicing or by proteolytic cleavage (PMID: 10480910; 15265897). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
