Anti-Mouse IL-15 Rabbit Recombinant Antibody Proteintech 98036-1-RR
$299.00
In stock
SKU
98036-1-RR
230285B3, AI503618, Il15, interleukin 15
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0359 Product name: recombinant mouse il15 protein Source: mammalian cells-derived, pHZ-KIsec-Cfc-2 Tag: C-FC Domain: 49-162 aa of NM_001254747 Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：16168 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Background Information：IL-15 is a 4-α-helix bundle cytokine playing a pivotal role in stimulation of both innate and adaptive immune cells. It is produced primarily by keratinocytes, skeletal muscle cells, monocytes, and CD4+ T cells. It is a member of the common gamma chain family. The members of the common gamma chain family include the IL-2, IL-4, IL-7, IL-9, and IL-21 and require binding to the common gamma chain receptor for activation. It can be used in growth and maintenance of T and NK cells. It is also shown to be used in proliferation and functional effect of T cells for adoptive cell therapy. It is a glycosylated protein and HumanKine IL-15 appear as 12.5-25 kDa bands (PMID: 24587813, 26627006, 27849617, 31250350) | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review