Anti-Mouse IL-13 Rabbit Recombinant Antibody Proteintech 98003-1-RR
$299.00
In stock
SKU
98003-1-RR
Il13, 2C14, Il 13, interleukin 13, Interleukin-13
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0266 Product name: Recombinant Mouse IL-13 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-131 aa of NM_008355 Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：16163 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide6 |
| Background Information：Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be an important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases, including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
