Anti-Mouse CXCR2 Rabbit Recombinant Antibody Proteintech 98353-4-RR
$299.00
In stock
SKU
98353-4-RR
CD182, Cmkar2, C-X-C chemokine receptor type 2, CXC-R2, CXCR-2
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12765 | Formulation:：PBS, Azide5 |
| Storage Buffer：P35343 | Formulation:：PBS, Azide6 |
| Background Information：CXCR2, also named as CD182, Cmkar2, Gpcr16, or Il8rb, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
